≥99% HPLCBatch testedIdentity by MS, purity by HPLC
Lot numberedCertificate filed per lot
Cold stored2 to 8 °C until dispatch
VIP
5mg lyophilised powderCAS 40077-57-4
A neuropeptide studied through VPAC receptors in neuroimmune, smooth-muscle and neuroendocrine signalling.
£27.90per vial, VAT included
In stock, dispatched same day before 16:00
- Free shipping on UK orders over £20.00
- Same day dispatch on orders placed before 16:00
- Batch certificate in the COA Database
Sold for research purposes only. For in-vitro laboratory research. Not a medicine and not for human or animal consumption. Supplied to qualified individuals aged 18 and over; you confirm this at checkout.
Research overview
VIP, or vasoactive intestinal peptide, is a 28-residue neuropeptide with a C-terminal amide (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2). It is studied through VPAC receptors in neuroimmune, gut-tissue and neuroendocrine signalling, using receptor-expressing cell lines, immune cells and isolated tissue preparations. Supplied at 5mg as a lyophilised powder for in-vitro laboratory research only.
VIP acts mainly at two class B G protein-coupled receptors, VPAC1 and VPAC2, and more weakly at PAC1. These receptors couple to Gs and raise intracellular cAMP, with some coupling to phospholipase C in certain cells. VIP is widely distributed in the nervous system and gut. Cell and tissue studies describe roles in immune cell cytokine regulation, relaxation of isolated tissue strips, epithelial secretion and neuroendocrine release, and its short half-life in biological media is an experimental consideration.
Laboratory use includes cAMP and receptor-binding assays in VPAC1- or VPAC2-expressing cells, cytokine release assays in macrophages and T cells, organ bath work on isolated tissue, and neuronal culture studies. Because it is cleaved quickly by peptidases, stability and degradation studies by HPLC are common. It is supplied as a lyophilised powder in a 5mg vial.
Research areas
- VPAC1 and VPAC2 receptor signalling
- cAMP accumulation assays
- Cytokine regulation in immune cell models
- Isolated tissue organ bath studies
- Peptidase degradation of neuropeptides
Specifications
- CAS number
- 40077-57-4
- Molecular weight
- 3325.83 g/mol
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (28-mer, C-terminal amide)
- Form
- lyophilised powder
- Purity
- ≥99% (HPLC)
- Also known as
- VIP, Vasoactive Intestinal Peptide, Intestinal Vasodilator Peptide
- Supplied as
- 5mg per vial, lyophilised powder
Storage and handling
Store the lyophilised powder in a freezer, protected from moisture and light, and let the vial reach room temperature before opening. Reconstitute with an appropriate laboratory diluent and keep reconstituted material cold.
Certificates of analysis
Each lot of VIP is released with a certificate recording identity and purity. Enter the lot number printed on your vial on the lab testing page to view it.
Questions
Which receptors does VIP act on?
VIP binds VPAC1 and VPAC2 with high affinity and PAC1 more weakly. All three are class B G protein-coupled receptors, and VPAC1 and VPAC2 mainly signal through cAMP.
How is VIP supplied and stored?
It is supplied as a lyophilised powder in a 5mg vial. Keep it cold, dry and away from light, and reconstitute with a suitable laboratory diluent only when the material is needed.
Is VIP a medicine?
No. It is supplied strictly for in-vitro laboratory research. It is not a medicine, food or supplement, and it is not for human or animal use. Buyers must be aged 18 or over.
Neuro and signalling
Studied alongside
