Growth axis
CJC-1295 with DAC
A GHRH 1-29 analogue carrying a drug-affinity-complex modification for longer persistence
£20.902mg
≥99% HPLCBatch testedIdentity by MS, purity by HPLC
Lot numberedCertificate filed per lot
Cold stored2 to 8 °C until dispatch
Tesamorelin
5mg lyophilised powderCAS 901758-09-6
A stabilised GHRH analogue used to study GHRH receptor activation and growth-hormone regulation in pituitary cell models.
£27.90per vial, VAT included
In stock, dispatched same day before 16:00
- Free shipping on UK orders over £20.00
- Same day dispatch on orders placed before 16:00
- Batch certificate in the COA Database
Sold for research purposes only. For in-vitro laboratory research. Not a medicine and not for human or animal consumption. Supplied to qualified individuals aged 18 and over; you confirm this at checkout.
Research overview
Tesamorelin is a stabilised analogue of growth-hormone-releasing hormone: a 44-residue peptide carrying an N-terminal trans-3-hexenoyl group and a C-terminal amide, also listed as TH9507. It is studied in vitro for GHRH receptor activation and growth-hormone regulation in pituitary cell models. Supplied at 5mg as a lyophilised powder for in-vitro laboratory research only.
Tesamorelin keeps the full GHRH sequence and adds a trans-3-hexenoyl group to the N-terminal tyrosine. In the literature this change is described as protecting the peptide from dipeptidyl peptidase IV, which otherwise inactivates the native hormone within minutes in biological fluids. Binding at the pituitary GHRH receptor raises cAMP in the same way as the native peptide, so it is used where a more persistent GHRH receptor agonist is wanted.
Research applications include GHRH receptor-binding and cAMP studies in transfected cells, release assays in primary pituitary cultures, and analytical work comparing the net peptide with its acetate salt. The specifications on this page give both net-peptide and acetate-salt values, so check which applies to a given calculation. It is supplied as a lyophilised powder.
Research areas
- GHRH receptor activation and cAMP signalling
- Pituitary cell growth-hormone regulation models
- N-terminal modification and peptidase resistance
- Net peptide versus salt-form analytical work
- Comparison with sermorelin and CJC-1295
Specifications
- CAS number
- 901758-09-6
- Molecular formula
- C221H366N72O67S (net peptide); C223H370N72O69S (mono-acetate salt, as supplied)
- Molecular weight
- 5135.91 (net peptide); 5195.96 (mono-acetate salt, as supplied)
- Sequence
- (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (N-terminal trans-3-hexenoyl; C-terminal amide)
- Form
- lyophilised powder
- Purity
- ≥99% (HPLC)
- Also known as
- Tesamorelin, TH9507, Growth Hormone-Releasing Hormone (GHRH) analogue
- Supplied as
- 5mg per vial, lyophilised powder
Storage and handling
Store the lyophilised powder in a freezer, protected from moisture and light, and let the vial reach room temperature before opening. Reconstitute with an appropriate laboratory diluent, aliquot, and keep reconstituted material cold.
Certificates of analysis
Each lot of Tesamorelin is released with a certificate recording identity and purity. Enter the lot number printed on your vial on the lab testing page to view it.
Questions
How is tesamorelin related to sermorelin?
Both are GHRH analogues. Sermorelin is the 29-residue fragment, while tesamorelin keeps the full 44-residue sequence and adds an N-terminal trans-3-hexenoyl group to resist peptidase cleavage.
Which form is supplied?
It is supplied as a lyophilised powder in a 5mg vial, as the mono-acetate salt. Keep it cold, dry and away from light until it is needed.
Is tesamorelin a medicine?
No. The material sold here is supplied strictly for in-vitro laboratory research. It is not a medicine, food or supplement, and it is not for human or animal use. Buyers must be aged 18 or over.
Growth axis
Studied alongside
