≥99% HPLCBatch testedIdentity by MS, purity by HPLC
Lot numberedCertificate filed per lot
Cold stored2 to 8 °C until dispatch
LL37
5mg lyophilised powderCAS 154947-66-7
The human cathelicidin host-defence peptide, studied in innate immunity, antimicrobial membrane action and wound biology.
£29.95per vial, VAT included
In stock, dispatched same day before 16:00
- Free shipping on UK orders over £20.00
- Same day dispatch on orders placed before 16:00
- Batch certificate in the COA Database
Sold for research purposes only. For in-vitro laboratory research. Not a medicine and not for human or animal consumption. Supplied to qualified individuals aged 18 and over; you confirm this at checkout.
Research overview
LL37 is the 37-residue human cathelicidin host-defence peptide, with the sequence [LL-37, 37 aa] It is studied in innate immunity, in antimicrobial membrane action and in wound biology, using bacterial, epithelial and immune cell models alongside biophysical assays. Supplied at 5mg as a lyophilised powder for in-vitro laboratory research only.
LL37 is released by proteolytic cleavage of the C-terminal domain of the precursor CAP-18. It forms an amphipathic alpha-helix in membrane environments, and the positive charge of that helix is thought to drive binding to negatively charged bacterial membranes. Beyond direct antimicrobial action it has been reported to signal through receptors such as FPR2 and P2X7 on immune and epithelial cells, to influence cytokine release, and to modulate cell migration and angiogenesis in vitro.
Laboratory use includes minimum inhibitory concentration assays against bacterial strains, membrane permeabilisation and liposome leakage assays, biofilm studies, and cell-based assays of chemotaxis and cytokine release in neutrophils, macrophages and keratinocytes. Biophysical groups study its helix formation by circular dichroism and its binding to model membranes. It is supplied as a lyophilised powder.
Research areas
- Antimicrobial membrane action and liposome leakage
- Biofilm inhibition assays
- FPR2 and P2X7 signalling in immune cells
- Chemotaxis and cytokine release in cell models
- Peptide secondary structure by circular dichroism
Specifications
- CAS number
- 154947-66-7
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.33 g/mol
- Sequence
- [LL-37, 37 aa] (37-residue cathelicidin peptide)
- Form
- lyophilised powder
- Purity
- ≥99% (HPLC)
- Also known as
- LL-37, CAP-18 (C-terminal fragment), Human Cathelicidin Antimicrobial Peptide
- Supplied as
- 5mg per vial, lyophilised powder
Storage and handling
Store the lyophilised powder in a freezer, protected from moisture and light, and let the vial reach room temperature before opening. Reconstitute with an appropriate laboratory diluent and keep reconstituted material cold.
Certificates of analysis
Each lot of LL37 is released with a certificate recording identity and purity. Enter the lot number printed on your vial on the lab testing page to view it.
Questions
What is LL37?
LL37 is the only cathelicidin peptide found in humans. It is the 37-residue C-terminal fragment of the precursor CAP-18, hence the name, and it forms part of the innate immune system.
How is LL37 supplied?
It is supplied as a lyophilised powder in a 5mg vial. The peptide is highly charged and can stick to some plastics, so many labs use low-binding tubes after reconstitution.
Is LL37 a medicine?
No. It is supplied strictly for in-vitro laboratory research. It is not a medicine, food or supplement, and it is not for human or animal use. Buyers must be aged 18 or over.
Tissue and repair
Studied alongside
Tissue and repair
BPC-157
A fifteen-residue synthetic peptide derived from a gastric protein sequence
£13.995mg
Tissue and repair
BPC-157 + TB-500 Mixture
A fixed one-to-one pre-mix of two separately sold peptides
£26.905mg + 5mg