Growth axis
CJC-1295 with DAC
A GHRH 1-29 analogue carrying a drug-affinity-complex modification for longer persistence
£20.902mg
≥99% HPLCBatch testedIdentity by MS, purity by HPLC
Lot numberedCertificate filed per lot
Cold stored2 to 8 °C until dispatch
IGF1-LR3
1mg lyophilised powderCAS 946870-92-4
A modified, long-acting IGF-1 analogue used to study IGF-1 receptor activation and growth-factor signalling.
£34.95per vial, VAT included
In stock, dispatched same day before 16:00
- Free shipping on UK orders over £20.00
- Same day dispatch on orders placed before 16:00
- Batch certificate in the COA Database
Sold for research purposes only. For in-vitro laboratory research. Not a medicine and not for human or animal consumption. Supplied to qualified individuals aged 18 and over; you confirm this at checkout.
Research overview
IGF1-LR3 is a recombinant analogue of insulin-like growth factor 1, an 83-amino-acid protein known as Long Arg3 IGF-1, with three intramolecular disulfide bonds. It is studied in vitro for IGF-1 receptor activation and growth-factor signalling. Supplied at 1mg as a lyophilised powder for in-vitro laboratory research only.
IGF1-LR3 binds the IGF-1 receptor, a receptor tyrosine kinase, and activates the PI3K-Akt and MAPK-ERK pathways. The Long-R3 modifications are described in the literature as sharply reducing binding to IGF-binding proteins, which normally limit how much free IGF-1 is available in culture. As a result it is reported to be more potent than native IGF-1 in many cell assays, and it stays active in media where binding proteins are present.
It is widely used as an additive in serum-free cell culture media, where it supports proliferation of cell lines used in bioproduction. Other uses include phosphorylation assays for Akt and ERK, myoblast differentiation work, and comparison with native IGF-1 and insulin. The protein is supplied as a lyophilised powder in a 1mg vial.
Research areas
- IGF-1 receptor activation and tyrosine kinase signalling
- PI3K-Akt and MAPK-ERK pathway phosphorylation
- Serum-free culture media additive use
- Myoblast proliferation and differentiation assays
- IGF-binding protein interactions
Specifications
- CAS number
- 946870-92-4
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9117.5 g/mol
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Long-R3 IGF-1, 83 aa; 3 intramolecular disulfide bonds)
- Form
- lyophilised powder
- Purity
- ≥99% (HPLC)
- Also known as
- IGF-1 LR3, Long Arg³ IGF-1, Insulin-Like Growth Factor-1 LR3, Recombinant IGF-1 analogue
- Supplied as
- 1mg per vial, lyophilised powder
Storage and handling
Store the lyophilised protein cold, dry and protected from light, and let the vial reach room temperature before opening. Reconstitute with an appropriate laboratory diluent, aliquot, and avoid repeated freeze and thaw.
Certificates of analysis
Each lot of IGF1-LR3 is released with a certificate recording identity and purity. Enter the lot number printed on your vial on the lab testing page to view it.
Questions
How does IGF1-LR3 differ from native IGF-1?
It is an engineered long form with an arginine at position 3. These changes are reported to reduce binding to IGF-binding proteins, which leaves more free ligand available to the IGF-1 receptor in culture.
How should the protein be handled?
It is a lyophilised powder in a 1mg vial. Keep it cold, dry and away from light. As with most proteins, aliquot after reconstitution to limit repeated freezing and thawing.
Is IGF1-LR3 a medicine?
No. It is supplied strictly for in-vitro laboratory research. It is not a medicine, food or supplement, and it is not for human or animal use. Buyers must be aged 18 or over.
Growth axis
Studied alongside
